SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0DW28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0DW28
Domain Number - Region: 141-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00034
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0DW28
Sequence length 193
Comment (tr|B0DW28|B0DW28_LACBS) Predicted protein {ECO:0000313|EMBL:EDR01240.1} KW=Complete proteome; Reference proteome OX=486041 OS=deceiver) (Laccaria laccata var. bicolor). GN=LACBIDRAFT_312388 OC=Laccaria.
Sequence
MIKVVATSQYTMSRNRGILYKPGFPGQAEGACQSCILSGCWERTRNTQELINEIVEGAPS
FWRSIITPHLFQDLEQLRLSVKFHEDSLLNMGGAKENTQQSPYNPFRNVHVNLVGWTKAT
SNPQFPKDDSNVSLHGMLDEKGARPCRHCGSRKHWDRDCKYTRKGEKRARANMVTTAAED
EQAQEDYDNAYYK
Download sequence
Identical sequences B0DW28
jgi|Lacbi1|312388|eu2.Lbscf0051g01070 XP_001888116.1.58555 29883.JGI312388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]