SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0JQG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JQG4
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily L21p-like 5.89e-36
Family Ribosomal protein L21p 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0JQG4
Sequence length 129
Comment (sp|B0JQG4|RL21_MICAN) 50S ribosomal protein L21 {ECO:0000255|HAMAP-Rule:MF_01363} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_08010; OC=Microcystaceae; Microcystis.
Sequence
MSYAIIETGGKQIRVEPGRYYDIELLPVDEQSTHTIDKVLLIHDEDDISIGQPFIEGATV
EGTVIQHRRGKKVIVYKMRPKKKTRKKRGHRQEITRFMIDSINYNGKTLVATAATSSAEV
VEDSSDEEE
Download sequence
Identical sequences A0A139GQU5 A0A1V4BY04 B0JQG4 I4FPV1
WP_002760284.1.24258 WP_002760284.1.4043 WP_002760284.1.52201 WP_002760284.1.79847 449447.MAE_08010 gi|166363542|ref|YP_001655815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]