SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0JYF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JYF7
Domain Number 1 Region: 221-357
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.32e-23
Family Pentapeptide repeats 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JYF7
Sequence length 403
Comment (tr|B0JYF7|B0JYF7_MICAN) Pentapeptide repeat family protein {ECO:0000313|EMBL:BAG05195.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_53730 OC=Microcystaceae; Microcystis.
Sequence
MKASEVLDLYAKGKRNFKGVKLKGQCFQGKNLSGANFSQADLRGTNFQGAILEGTKFTEA
RAGLLKRGRLQLILISWLIAAICGCLWGLAGYYLALMLVTDVTEFKIIGAVIITILSLIY
GIFYRQRVGGLPLVLSLISGQKISFILAIFISLILTLLIVIILAFQGALAGIAVMNVTFS
IALIVGVCVTLFTAYLAWLSLEESRETITKFMAIAFLASKGTNFCGANLQEADFTGAQLK
ATDLRAKDLTRTRFYLVSGIERARWEKTILDEVAMRNLLVTGQGENKAYIGYNFRGLNLY
GFNFKNANLTRANFSEANLAYANLEGANLAHSNVMRANLQGATLTGACIEAWKIAENTNL
EGVDCDYIYLVECDRERRPREGEFGEGEFRQLALEQRKLYIDE
Download sequence
Identical sequences B0JYF7
WP_012267717.1.4043 gi|166368114|ref|YP_001660387.1| 449447.MAE_53730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]