SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0KMN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0KMN3
Domain Number 1 Region: 29-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.45e-90
Family Phosphate binding protein-like 0.0000000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0KMN3
Sequence length 367
Comment (tr|B0KMN3|B0KMN3_PSEPG) Extracellular solute-binding protein family 1 {ECO:0000313|EMBL:ABY98089.1} KW=Complete proteome OX=76869 OS=Pseudomonas putida (strain GB-1). GN=PputGB1_2188 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRKVLKMIGGLLLASGASLAQAAEVDSANTLRLYNWTDYIGETTLADFEKATGIKVIYDT
FDGYETVQTKLLTGRSGYDLVMLNASLVPPLISAGVFQALDKQQLPSWHNLDQQVVDNLQ
GYDPGLKYSAPYTWGSSGVTYNVDKIKARMPDAPIGSLAMLFDPKIVSRFADCGVTLMDA
PTEVIPLALQYLGKDPRSASPADLKAAEQLLLGIRPYIRKFDSVNYLTSLPNGDVCLALT
WSGDYATAQARAVEAKKDIKLSFFIPQEGSLIWFDNLYIPKDAPHAANAHRFIEFLLQPQ
TMAKVTDYIHYANSNAAATALVRDDIRQDPAIYPDASTRERLFAQKTQSPKDMRAITRVW
STVKTGF
Download sequence
Identical sequences B0KMN3
76869.PputGB1_2188 gi|167033194|ref|YP_001668425.1| WP_012271838.1.81634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]