SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0KNJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0KNJ0
Domain Number 1 Region: 215-317
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 8.39e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.012
Further Details:      
 
Domain Number 2 Region: 98-226
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.46e-28
Family Aromatic dioxygenase reductase-like 0.0048
Further Details:      
 
Domain Number 3 Region: 4-100
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.65e-22
Family Ferredoxin reductase FAD-binding domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0KNJ0
Sequence length 319
Comment (tr|B0KNJ0|B0KNJ0_PSEPG) Ferredoxin {ECO:0000313|EMBL:ABY98113.1} KW=Complete proteome OX=76869 OS=Pseudomonas putida (strain GB-1). GN=PputGB1_2212 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNEELLNVVVRKREIQGADVVVLDLGRADGAALPAFEAGAHVDIHVAPGLVRQYSLCSDP
ADVTVYRLGVLKDPASRGGSVGVHEALMEGREVQISAPRNLFPLAAGAARSILLGGGIGI
TPMIAMAHALHQQGADFELHYCGRSRSRSAFLEALADAPFAARVVTHFDDEEATQRLNLA
DVLGAGMPGTHLYTCGPSGFMDWVIAGARQQGYAEEHIHKEYFQVEVDATGQGFEVVAAR
SNKTVQVAEGQTILDALAQVGIRIDISCEQGVCGTCMCEVLEGEPDHRDVYLTDEEKAAN
DQILVCCSRAKSNKLVLDI
Download sequence
Identical sequences B0KNJ0
WP_012271861.1.54657 WP_012271861.1.65540 WP_012271861.1.66485 WP_012271861.1.81634 gi|167033218|ref|YP_001668449.1| 76869.PputGB1_2212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]