SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0KUG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0KUG4
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.99e-60
Family Phosphate binding protein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0KUG4
Sequence length 305
Comment (tr|B0KUG4|B0KUG4_PSEPG) Extracellular solute-binding protein family 3 {ECO:0000313|EMBL:ABZ00230.1} KW=Complete proteome OX=76869 OS=Pseudomonas putida (strain GB-1). GN=PputGB1_4341 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MRIVRQLLGAAIAAAVIASPAMAEELTGTLKKIKDSGTITLGHRDSSIPFSYLAGKPEPV
GYSHDIQLAVVDALKKQLGTDIKVKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQQV
GFSVGIFEVGTRLLTKVKDGQPAYKDFPDLAGKNVVTTAGTTSERILKAMNADKQMKMNV
ISAKDHGEAFNMLESGRAVAFMMDDALLAGEMAKARKPSDWVITGTPQSYEIYGCMVRKE
DAAFKKAVDDAIVGYFKSGEVNKSYEKWFMQPIPPKGLNLQFQMSDELKKLIAEPTDKAA
DEKKS
Download sequence
Identical sequences B0KUG4
76869.PputGB1_4341 WP_012273897.1.13892 WP_012273897.1.54657 WP_012273897.1.65540 WP_012273897.1.66485 WP_012273897.1.81634 gi|167035334|ref|YP_001670565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]