SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0QZD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0QZD3
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-40
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0QZD3
Sequence length 146
Comment (tr|B0QZD3|B0QZD3_HUMAN) Rho guanine nucleotide exchange factor 16 {ECO:0000313|Ensembl:ENSP00000411936} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGEF16 OC=Catarrhini; Hominidae; Homo.
Sequence
MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQ
RHKAQVLVEDISDILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERR
PACGGLPMLSFLILPMQRVTRLPLLM
Download sequence
Identical sequences B0QZD3
ENSP00000411936 ENSP00000411936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]