SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0R4Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0R4Z1
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-40
Family GHMP Kinase, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 191-303
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.32e-27
Family Mevalonate kinase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0R4Z1
Sequence length 330
Comment (tr|B0R4Z1|B0R4Z1_HALS3) Mevalonate kinase {ECO:0000256|HAMAP-Rule:MF_00217} KW=Complete proteome OX=478009 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1). GN=OE_2645F OC=Halobacteriaceae; Halobacterium.
Sequence
MTTTSSAPGKVYLFGEHAVVYGEPAVPCAIERRAHVTVSEREDSRLRVCSGDLSIDGFTV
EYSGDRDAGGTPDVDVPAPIVDAAMGYVDAAVEQARAAADAPTAGFDVTIDSEIPLGAGL
GSSAAVVVAGIDAATRELGVELDAREVADRAYQVEHTVQDGEASRADTFCSAMGGVVRVS
GDDCTTLDAPALPFVIGYDGTSHDTGELVAGVRALREEFGFVADTVTAIGDLVRRGEAAL
ADGDVATLGRLMDINHGLLSGLGVSGRTLDAMVWAARDGGADGAKLTGAGGGGSIVALDA
GSGAETALSLTPDCEAAFRADLAREGVRVE
Download sequence
Identical sequences B0R4Z1 Q9HQI6
WP_010902824.1.1784 WP_010902824.1.50382 478009.OE2645F 64091.VNG1145G gi|169235954|ref|YP_001689154.1| gi|15790225|ref|NP_280049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]