SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0R6D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0R6D7
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-31
Family GHMP Kinase, N-terminal domain 0.0000439
Further Details:      
 
Domain Number 2 Region: 156-273
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.25e-21
Family Homoserine kinase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0R6D7
Sequence length 301
Comment (sp|B0R6D7|KHSE_HALS3) Homoserine kinase {ECO:0000255|HAMAP-Rule:MF_00384} KW=Complete proteome OX=478009 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1). GN=OE_3531R; OC=Halobacteriaceae; Halobacterium.
Sequence
MVVTVRAPATSANLGSGFDVFGVALSKPADVVRVERADTTTITVTGAGAQYVPTDPQENT
AGVVAAALDAPATIHINKGVRPSSGLGSSAASAAAATVALAELYDRPLDDDALVRAAAQG
EAAASGVAHADNVAPAILGGFTIVREDGIEHVDASLALAVCLPETTVSTRDARGVVPESA
AMEAVVSTVESAATLTLGMCENDPQRVGRGVEDALVTPARARLMDGYEAASAAARDAGAT
GVTISGSGPGVVAVCRRRDRKRVAAALVDGFDSAGVAASAYQTRIGDGATRLAADGDDRA
P
Download sequence
Identical sequences B0R6D7 Q9HP55
WP_010903313.1.1784 WP_010903313.1.50382 478009.OE3531R 64091.VNG1797G gi|169236452|ref|YP_001689652.1| gi|15790711|ref|NP_280535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]