SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0TB22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0TB22
Domain Number 1 Region: 788-1168
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.24e-137
Family PFOR PP module 0.00000000119
Further Details:      
 
Domain Number 2 Region: 415-666
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.18e-88
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000382
Further Details:      
 
Domain Number 3 Region: 5-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.88e-78
Family PFOR Pyr module 0.00000000897
Further Details:      
 
Domain Number 4 Region: 260-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.43e-49
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000916
Further Details:      
 
Domain Number 5 Region: 665-833
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.37e-20
Family Ferredoxin domains from multidomain proteins 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0TB22
Sequence length 1170
Comment (tr|B0TB22|B0TB22_HELMI) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome; Reference proteome OX=498761 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1). GN=HM1_0807 OC=Heliobacterium.
Sequence
MSKVMQTMDGNKAAAYVSYAFTECAAIYPITPSSTMAEYVDEWSAQGKKNIFGQTVTVAE
MQSEAGAAGAVHGALTAGSLTTTYTASQGLLLMIPNMYKISGELLPGVMHVSARAVAGHA
LSIFGDHSDVMACRQTGWAMLASGSVQEVMDLGGIAHLAAIKSRVPFLHFFDGFRTSHEM
QKIEIIDYADFAKLVDYEAVRAFRKRGLNPEHPSVRGTAQNPDIFFQAKEACNPYYKGVA
DIVAGYMKEIGKLTGRDYLPFNYYGAPDAERIIVAMGSVCDTIEETIDYLLARGEKVGLI
KVRLYKPFSAKYFFDVLPATVQKIAVLDRCKEPGSLGEPLYEDVRTLFYDAACQPLIVGG
RYGLGSKEVLPSDIKAVFDNLKADEPKNGFTIGIVDDVTFLSLPTGSFIDTAPEGTIQCK
FWGLGSDGTVGANKQAVEIIGDHTDMYAQAYFAYDSKKSGGVTVSHLRFGHKPIKSPYLI
HKADFISCSNQSYVYNYDLLAGLKEGGVFLLNTVWSPEELEEKLPARIKRTIAEKRIRFY
TIDAVHIAKKLGLGNRTNMVMQSAFFKLANVIPIEEAVQYLKEGIKKAYGKKGESVVAMN
AAAVDQGIEALVKIDVPASWAEAVDEAAATMEVPAFIEKILQPMNALQGDKLPVSAFADA
ADGTFPVETSRYEKRGVAAFVPEWIKENCIQCNQCSFVCPHAAIRPFLLNAEEQAKAPAT
FETIKAIGGKQFEGLTYRLQVTPLDCQGCGVCVMTCPAKQKALTMKELDSQVAVQQPNWD
FATTLTIKDNLLKLDSIKGSQFAQPLLEFSGACAGCGETPYVKLITQLFGDRMIIANATG
CSSIWGASAPSVPYCTNKEGKGPAWANSLFEDNAEFGYGMHLGVSKIRAKLADLVREALT
QDIDAALKAAFNEWLVGMDDAEASKQATAKILPLLEGQTHPLLAEIADRKDYLIKKSQWI
FGGDGWAYDIGFGGLDHVLASGEDVNILVMDTEVYSNTGGQSSKATPLSAIAKFASAGKR
TKKKDLGLMAMSYGYVYVAQIAMGADMNQTIRAIKEAEAYKGPSLIIAYASCINHGLKSG
MANSQIEMARAVKSGYWHLYRFNPELKEEGKNPFILESKEPSESFRDFIMSEVRFNALCR
SYPEQAELLFSKMEQDAKERYEMYKRLASF
Download sequence
Identical sequences B0TB22
gi|167629261|ref|YP_001679760.1| 498761.HM1_0807 WP_012282272.1.33279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]