SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0TS64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0TS64
Domain Number 1 Region: 22-294
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.82e-92
Family Methylenetetrahydrofolate reductase 0.00000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0TS64
Sequence length 296
Comment (tr|B0TS64|B0TS64_SHEHH) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome OX=458817 OS=Shewanella halifaxensis (strain HAW-EB4). GN=Shal_0624 OC=Shewanellaceae; Shewanella.
Sequence
MGFHHAQHATSLNQSLSELNGDINVSFEFFPPSTPEMEKLLWNSIRRLEPLNPKFVSVTY
GANSGVRDRTHGVIERIQKETDLVAAPHLTLVDASDEELKELAKHYWNSGIRDIVALRGD
LPEGSPKPTRFANDLVSLLRSVADFDISVAAYPEVHPDASNAQSDLIHLKKKIDAGANRA
ITQFFFDVESYLRFRDRCAAAGIDAEIVPGILPVTNFNQTKRFAAMTNVSIPSWLHRQFE
GLEDDPTTRQMVGANVAIDMVKVLSREGVKDFHFYTLNRAELTYAICHTLGVRPGK
Download sequence
Identical sequences B0TS64
458817.Shal_0624 WP_012275753.1.86919 gi|167622564|ref|YP_001672858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]