SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0XP54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0XP54
Domain Number 1 Region: 367-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.21e-41
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 300-374
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.03e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.014
Further Details:      
 
Domain Number 3 Region: 104-254
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000131
Family B3/B4 domain of PheRS, PheT 0.014
Further Details:      
 
Domain Number 4 Region: 4-77
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000229
Family Domains B1 and B5 of PheRS-beta, PheT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0XP54
Sequence length 600
Comment (tr|B0XP54|B0XP54_ASPFC) Phenylalanyl-tRNA synthetase, beta subunit {ECO:0000313|EMBL:EDP55897.1} KW=Complete proteome OX=451804 OS=(Aspergillus fumigatus). GN=AFUB_005990 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPTISVDKAALFKELGREYTTEEFDELCFEFGIELDEDTTNSDRPIVDGKQEPPQLKIEI
PANRYDLLCFEGIQLMLNIFLGRKPLPNYRLVEPANGQLEKIIVKEDTMKVRPLVSGAIL
RNIKFDKARYESFIALQDKLHQNLARQRTLVSIGTHDLDTIQGPFTYEALPPKDIKFVPL
NQTKELNGEELMSFYEKDKHLGKYLHIIRDSPVYPVIYDSKRTVCSLPPIINGDHSKITL
DTKNVLIEITALDKTKLDIVTKIMVTMFSQYTSKPFTVEPVQIVSEHNNETRVEPDIAPR
TTQAEVSYINQCCGLELSPEEICKLLTKMAYQARPSASSPDLIDVDVPPTRADVLHQADI
MEDVAIAYGFNSLPRSFPSKSGTIAQPLPINKLSDIVRMEAAMAGWTEVLPLILCSHDEN
FAWLNRKDDGTTAVKLANPKTVEFQVVRTSLLPGLLKTIRENKHHAVPIKIFECSDVAFK
DLTLERKSRNERHFAAAWYGRTSGFEVVHGLLDRIMAMLKSAFITGEECLENPAVNDSHY
WIEELDEPTYFPGHAASIHLRIAGKDHVIGAFGILHPTVLEKYELKYPVSTLEINIEAFL
Download sequence
Identical sequences B0XP54 Q4WJK9
XP_750311.1.65241 Afu1g05620 5085.CADAFUAP00009272 Afum_A1163:AFUB_005990.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]