SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0XQ67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0XQ67
Domain Number 1 Region: 21-109,198-432
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.31e-76
Family IF2B-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0XQ67
Sequence length 439
Comment (tr|B0XQ67|B0XQ67_ASPFC) Translation regulator GCD7 {ECO:0000313|EMBL:EDP56181.1} KW=Complete proteome OX=451804 OS=(Aspergillus fumigatus). GN=AFUB_008900 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPTTSAALTPGLASFLKSLKTTPIDTSIDNLISLLKRRQIRHSRSCATATAYLLLRVVSA
CRTTDAAKLIERVQSVGRRLVAAQPREMVVGNIVRRVLGLIRDEAEDERDGDFTLSDAGS
EGQPQTPRVSEDPSDPLSLRHEGSERSSSRPPFTSLATTPISMFNLLSHPEPETSLPGTP
ASASPSGRLLGHAPTRDIRAEVLDGIGEIIDELGQVDDQIAAYALDHIHSNEIILTHTSS
TTVQKFLLKAAAKRKFTVIHAESYPNNHEATHTTVSGAASTDEEILSTDSFQKPLIALGI
TVILIPDSAVFALMSRVNKVILGTHSVLANGGLVAAAGTRVIARAAKVHQTPVVVVSGVY
KLSPVYPFDFESLIEYGDASKVIPYEDGDLMDQVDVQNPLYDYVPPELVDLYITNLGGHA
PSYLYRIVSDHYRKEDINF
Download sequence
Identical sequences A0A229XSW1 B0XQ67 Q4WTF8
XP_752312.1.65241 Afu1g09450 Afum_A1163:AFUB_008900.t1 5085.CADAFUAP00007579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]