SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B0Y1T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0Y1T2
Domain Number 1 Region: 195-550
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.59e-84
Family IF2B-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0Y1T2
Sequence length 556
Comment (tr|B0Y1T2|B0Y1T2_ASPFC) Translation initiation factor eif-2b delta subunit {ECO:0000313|EMBL:EDP52041.1} KW=Complete proteome OX=451804 OS=(Aspergillus fumigatus). GN=AFUB_060750 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MATPINPPVPSSTSESATTAPAQQQSTSEMQPQQQQPPREPKGAAKNASKPAKQSQNPKE
GTPAADGASPADAGSQKLTPAELKKKAKAEKAARRAKERAEREQAGGAAPAQGANPPFAK
KGQTGAGGGGGAGGKDAAAAQSQKGRGYLPRRGSAQAAAGGAEQKKKQEDKNVAVFGHLY
GQQRRTTVAGAGKEVHPAVLALGLQMRDYVICGSSARCVATLLAFKRVIESYTTPLGTSL
ARHLTTHLSHQITYLSTCRPLSISQGNAIRALKLAISSIDPSVPEASAKASLSDFIDSFI
REKITVADQVIADSAAQKIQDGDVIVTYAGSSIVKQTLLTAHKQGKKFRVSIIDSRPLFE
GKNLARTLAKAGLEVQYSLVNGISHAIKDATKVFLGAHAMTSNGRLYSRVGTALVAMSAK
ERAGGVEVPVIVCCETVKFTDRVALDSIVVNEIADADELVMNEPLQQVTGLPDAAAVAQP
EPKKGNKSAANATPSESTVVTPGTSPLKDWKDTPNLQLLNIMYDVTPAEYVDMVVTEMGS
LPPSAVPIVHRMSTNM
Download sequence
Identical sequences B0Y1T2 Q4WVR4
Afum_A1163:AFUB_060750.t1 XP_753350.1.65241 5085.CADAFUAP00006189 Afu5g13040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]