SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1HUQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1HUQ8
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 2.09e-39
Family Hypothetical protein YfhH 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1HUQ8
Sequence length 109
Comment (tr|B1HUQ8|B1HUQ8_LYSSC) Uncharacterized protein {ECO:0000313|EMBL:ACA37938.1} KW=Complete proteome OX=444177 OS=Lysinibacillus sphaericus (strain C3-41). GN=Bsph_0309 OC=Lysinibacillus.
Sequence
MNEKNYAAMSEHELREEIAFLKEKARKAEQLGIINEFAVYERKALMAAAYLVDLNTIVPG
EMYRIDRSDNEFFQVDYLKGRFAWGHRLGGDKYQEALPVSMLSPVKVGK
Download sequence
Identical sequences A0A2G8GB99 B1HUQ8 W7RFX7
WP_012292101.1.18114 WP_012292101.1.47961 WP_012292101.1.54975 WP_012292101.1.60952 WP_012292101.1.62054 WP_012292101.1.73705 WP_012292101.1.92801 WP_012292101.1.93816 444177.Bsph_0309 gi|169825910|ref|YP_001696068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]