SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1I5K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1I5K6
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily AF1862-like 6.02e-28
Family Cas Cmr5-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1I5K6
Sequence length 125
Comment (tr|B1I5K6|B1I5K6_DESAP) CRISPR-associated protein, Cmr5 family {ECO:0000313|EMBL:ACA60315.1} KW=Complete proteome; Reference proteome OX=477974 OS=Desulforudis audaxviator (strain MP104C). GN=Daud_1819 OC=Candidatus Desulforudis.
Sequence
MQTRNQEYAAKIFEQVMQVRDELGKDGSNNYGSLAHRLPVFVRTAGLAQALAFVEARDGA
AGRKLLRDIAAVVNEEELLARSRTAELPEYMLLTRNVLAALAWYKRFAQSVLGVEAGADR
EGVGE
Download sequence
Identical sequences B1I5K6
gi|169831965|ref|YP_001717947.1| 477974.Daud_1819 WP_012302891.1.36146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]