SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1I919 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1I919
Domain Number 1 Region: 121-268
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.09e-48
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00018
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 4.09e-28
Family DHN aldolase/epimerase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1I919
Sequence length 270
Comment (tr|B1I919|B1I919_STRPI) 7,8-dihydroneopterin aldolase {ECO:0000256|RuleBase:RU362079} KW=Complete proteome OX=487214 OS=Streptococcus pneumoniae (strain Hungary19A-6). GN=SPH_0409 OC=Streptococcus.
Sequence
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPWGGVEQDSFTNQVVEVET
WLPAQVLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQTLYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
Download sequence
Identical sequences B1I919
487214.SPH_0409 WP_000372534.1.37623 WP_000372534.1.3864 WP_000372534.1.79671 gi|169834513|ref|YP_001693820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]