SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1KWH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B1KWH1
Domain Number - Region: 169-227
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000615
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1KWH1
Sequence length 234
Comment (tr|B1KWH1|B1KWH1_CLOBM) Conserved domain protein {ECO:0000313|EMBL:ACA53833.1} KW=Complete proteome OX=498214 OS=Clostridium botulinum (strain Loch Maree / Type A3). GN=CLK_1758 OC=Clostridium.
Sequence
MEIKNHIMDQKKVYIKIGYSSDDAEKAAIKDMGDPKATGKMLDSVHPPTIDWIQIIALIM
ITLTLQILKMLSELGGSDFSSIAPIDILRIIGIFLSAYALIWIGIEKYSDLPFFYGKSQR
GGSNANGVFICSLAIVMISHSLLQTIILLLIFAPIIAIERSIIESKRIKKEQKFLWQQGI
AYEDFNYKGNAIFNNSPRKVYSQNEPIKKGDPIIITKIDGFNLVVEKQDLHNNN
Download sequence
Identical sequences B1KWH1
gi|170758433|ref|YP_001787693.1| 498214.CLK_1758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]