SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1L653 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1L653
Domain Number 1 Region: 6-275
Classification Level Classification E-value
Superfamily Folate-binding domain 2.83e-86
Family Aminomethyltransferase folate-binding domain 0.00000147
Further Details:      
 
Domain Number 2 Region: 269-356
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 3.11e-19
Family Aminomethyltransferase beta-barrel domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1L653
Sequence length 372
Comment (tr|B1L653|B1L653_KORCO) Glycine cleavage system T protein {ECO:0000313|EMBL:ACB07932.1} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_1186 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MLRLGLADLHKELNAKFFEFAGWEMPMRYTNSLEEAMSVRTSCGIFDVSHMGRFIIEGTD
ASNFLQRATSNNVDVEIGRSKYTLTLNERGGIRDDNVAFRLSDNKYIFVVNAANRIKILS
WFDELRKKWDMNVRIDDVTLETFMFAIQGPRAREIFHNITGTQLKIKKFNITTVNWRGEE
LIVSRTGYTGEDGYEVIMRDRELASDLFRSLVGAGAKPCGLVARDILRLEAGLVLYGNDI
DEDTNPIEAGLEFAVDLEKDFVGKGAITEAINRGVERVRVGIMSSTRSAPRRGEGVYMGE
ERIGIVTSGTFSPTIERGIGMAYIKKEYAEIGKELTVGEERKLKVRVEKMPFYDEKIYGW
RRVTSTSQERHD
Download sequence
Identical sequences B1L653
374847.Kcr_1186 gi|170290799|ref|YP_001737615.1| WP_012309829.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]