SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1L6M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1L6M1
Domain Number 1 Region: 4-433
Classification Level Classification E-value
Superfamily L-aspartase-like 7.38e-108
Family L-aspartase/fumarase 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1L6M1
Sequence length 456
Comment (tr|B1L6M1|B1L6M1_KORCO) Adenylosuccinase {ECO:0000256|RuleBase:RU361172} KW=Complete proteome; Reference proteome OX=374847 OS=Korarchaeum cryptofilum (strain OPF8). GN=Kcr_1354 OC=Archaea; Candidatus Korarchaeota; Candidatus Korarchaeum.
Sequence
MWVHPIDSRYGSELMRAIFRQENRIKLMARVEALYARALAERGFIPKEAAEAIERAAEEV
TPEDVRAEEALVKHETMALVRAISKRAGRYGEYLHLGLTSNDVLDTVMGVQIRQAGSIIL
RSSASLLEKIVKRGEESLDIVCLGRTHGVVADPIPLSMKFALWSYYVRRSIARFMDSLNE
ASVGKLRGAVGTAAASIELGIKDPLEVESEVLAALGLSPPEITTQVVPRDRLAHLILSMS
LFSSALDTIANEIRNLHRTEISEVKEHFEERQVGSSTMPHKMNPINSEKVCGLARLMRSL
AIAALENVVLEHERDLTNSSVERAILPEAFLILEEQINTLSAVIENLEIDRVRIGENLEK
YGDIALSERLMIWLVKKGLGRQEAHEIVRSISLRSHRSGRRFIDEVLADESLSKILRPEE
IEAIFSPRSYLGLGRELSIEEFRAAREFLKEVLLNG
Download sequence
Identical sequences B1L6M1
WP_012309997.1.97847 374847.Kcr_1354 gi|170290967|ref|YP_001737783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]