SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1N573 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1N573
Domain Number 1 Region: 93-156
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000000000000017
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 16-133
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00000000085
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1N573
Sequence length 210
Comment (tr|B1N573|B1N573_ENTHI) 2, 3-bisphosphoglycerate-independentphosphoglycerate mutase, putative {ECO:0000313|EMBL:EDS88885.1} KW=Complete proteome; Reference proteome OX=5759 OS=Entamoeba histolytica. GN=EHI_112990 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEGLKPNTKLQPRQGPVVVCILDGFGIDKEGPGNCVTLANPPYYNKLLAEAKEQHLHTII
KANGPYVGLPTEADMGNSEVGHNALGAGQIYSQGTKLVEESIESGKFFETENWKNVVGAA
VKEGKTVHFIGLLSDGNVHSNTTQLFQMMDGVVKCGGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXQYNTLFKEFRKNSSINHET
Download sequence
Identical sequences B1N573
XP_001914339.1.49425 294381.B1N573 EnhiA.00400.a gi|169800273|gb|EDS88885.1| gi|183235905|ref|XP_001914339.1| jCVI|EHI_112990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]