SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1R3M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1R3M5
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily ITPase-like 1.57e-62
Family Maf-like 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1R3M5
Sequence length 192
Comment (tr|B1R3M5|B1R3M5_CLOPF) Maf-like protein AC1_2634 {ECO:0000256|HAMAP-Rule:MF_00528} KW=Complete proteome OX=451754 OS=Clostridium perfringens B str. ATCC 3626. GN=AC1_2634 OC=Clostridium.
Sequence
MKVILASKSPRRVEILEKIVKEFEVVQSNFDENTIDFKGDIEKYVKDLSRNKAIEVSKRL
NEPSIVIAADTVVFQNGKVLEKPKNEEDAFSMLSSLSGNTHKVYSGICLINTYDDTVVTD
CDCTEVRFSELNPRQIRNYINSGEPMDKAGAYGIQGLGGAFVEGIKGCYYNVMGLPLNKL
YKALENYDITIL
Download sequence
Identical sequences A0A173WWA5 B1R3M5 Q0TNG7
IDP04301 gi|110800698|ref|YP_696823.1| WP_003455083.1.10161 WP_003455083.1.2058 WP_003455083.1.20964 WP_003455083.1.22226 WP_003455083.1.27537 WP_003455083.1.30163 WP_003455083.1.50147 WP_003455083.1.52260 WP_003455083.1.5234 WP_003455083.1.52659 WP_003455083.1.68380 WP_003455083.1.81392 195103.CPF_2400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]