SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1Y6M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1Y6M3
Domain Number 1 Region: 11-94
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.63e-18
Family Anti-sigma factor antagonist SpoIIaa 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1Y6M3
Sequence length 110
Comment (tr|B1Y6M3|B1Y6M3_LEPCP) Anti-sigma-factor antagonist {ECO:0000313|EMBL:ACB36051.1} KW=Complete proteome; Reference proteome OX=395495 OS=discophora (strain SP-6)). GN=Lcho_3797 OC=Leptothrix.
Sequence
MDTDPKTGDAPRTLRIQGELSIFRATELKQALLAEPAATEIDLSGVTDIDTAGLQLLMLA
KKHARRSGREVRLVGHSPAVIELFELLHIAGHFGDPMVIDAPARDAPHRN
Download sequence
Identical sequences B1Y6M3
WP_012348798.1.27902 gi|171060467|ref|YP_001792816.1| 395495.Lcho_3797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]