SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1Y715 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1Y715
Domain Number 1 Region: 193-265
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 5.44e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1Y715
Sequence length 267
Comment (tr|B1Y715|B1Y715_LEPCP) Transcriptional regulator, LuxR family {ECO:0000313|EMBL:ACB33642.1} KW=Complete proteome; Reference proteome OX=395495 OS=discophora (strain SP-6)). GN=Lcho_1374 OC=Leptothrix.
Sequence
MPQPQSVERVPVEPEVSLQPQDIEALALNLDASLNVHTRSHFFTWTQGLLQGLIHHEALI
CVLRCPESATWRVDSFSTRVADSTVFAAPLLRDIALVPRLVDAWKGAHHLPIVLPARRDG
VLGSGAWVAELERIAATRLAVHGCHDIDGDANCLFLLACQGDSPDPRELCLLRLVVPFLR
EAWVRSQMIGGRHDDLPAPHGHAVITVREQEILKWIYLGKSNSEIGQILGISALTVKNHV
QKMLHKLNVVNRAQAVGRAIEAHLIQI
Download sequence
Identical sequences B1Y715
WP_012346404.1.27902 gi|171058058|ref|YP_001790407.1| 395495.Lcho_1374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]