SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1YEW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1YEW8
Domain Number 1 Region: 11-142
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-24
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 122-250
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000719
Family Potassium channel NAD-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B1YEW8
Sequence length 339
Comment (tr|B1YEW8|B1YEW8_EXIS2) Ion transport 2 domain protein {ECO:0000313|EMBL:ACB60726.1} KW=Complete proteome; Reference proteome OX=262543 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15). GN=Exig_1248 OC=Bacillales Family XII. Incertae Sedis; Exiguobacterium.
Sequence
MFGKDEKSMVWLRFLRRMSFLRMRTLAYASFLFVFGVALIMYLAEPDTFGTYFRAVYWTM
TTVVTVGYGDFFPNTDFGRFMTIFVFIFGIGIVGGLISKLVDGVQLIRNQKERGLLQVKE
TGHTLVFGYSRRSKHVIDELLETTDVILIDDLEREPFSHPRFHYVSGDPALDATLQRANI
KKATRAIVLADHSIPPALADGRTLLIAASIERANPNIYTIVEMMLEEHLDSFEQVKVDEV
LLGDETVARMAILAAYHPGVSKVVTNLLTKDGDGMFSLPAKPEWQTFRDAFHILLEDGVT
ILSDGKRLDLNRRLNEPIPPNTTLIVLCSEETAQRIGAV
Download sequence
Identical sequences B1YEW8
WP_012370147.1.68707 262543.Exig_1248 gi|172057283|ref|YP_001813743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]