SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1ZJR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1ZJR8
Domain Number 1 Region: 74-138,183-260
Classification Level Classification E-value
Superfamily CBS-domain pair 1.24e-32
Family CBS-domain pair 0.0064
Further Details:      
 
Domain Number 2 Region: 270-351
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000134
Family CorC/HlyC domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1ZJR8
Sequence length 384
Comment (tr|B1ZJR8|B1ZJR8_METPB) CBS domain containing protein {ECO:0000313|EMBL:ACB81553.1} KW=Complete proteome OX=441620 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001). GN=Mpop_3402 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MTNDRSRGAALAAPAADAEPPPREAWYDRLLNVFNLRPRDSLRTDIEEALAEPDTGEDAF
SPLERAMLKNVLGLHKVRVDDVMLPRADIVAVASDTSLGDLLRLFRTAGHSRLPVYGETL
DDPRGMVHIRDFVEYLATQAEAAPRRPAPRVVNDGEADGESKPAPRPRRTASARGALRSL
DLGKVDLTATLASTRIQRPVLFVPPSMPAIDLLVRMQATRTHMALVIDEYGGTDGLISIE
DLIEMVVGDIEDEHDVAEGRLVNRMEGEAEAYIADARAGLAEVSEATGLDLAAAFGEVAE
EIDTIGGLVVTLAGRVPERGERIAGPEDIEFEVLDADPRRVKRIKLQRAPAKIGTVVPLA
LPPPRAVPHSSAEPDTAQAAEAGR
Download sequence
Identical sequences A0A177J1Z6 B1ZJR8
441620.Mpop_3402 WP_012455270.1.72001 WP_012455270.1.78039 gi|188582643|ref|YP_001926088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]