SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B1ZSD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1ZSD7
Domain Number 1 Region: 447-553
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-17
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1ZSD7
Sequence length 606
Comment (tr|B1ZSD7|B1ZSD7_OPITP) Sulfate transporter {ECO:0000313|EMBL:ACB75736.1} KW=Complete proteome; Reference proteome OX=452637 OS=Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1). GN=Oter_2454 OC=Opitutus.
Sequence
MSEEGSSSYFAFRPKLMDCLRGYSRDRFMSDLAAGITVGVVALPLAMAFAIASGVPPQAG
IFTAVVAGFIISALGGTRVNIGGPTGAFIVILYGIYAKYGAENLAICTIMAGVILFLMGF
ARLGSMIKFIPYPVTMGFTSGIAVLIFSTQIKDFLGLSVEKVPSEFMEKMMVLGEHLGTT
QWPTLVLALASLAIIIFWPKGWQRRVPGSIVALVVGTVAAMLLKLPVETIGSRFGDIPQA
LPAIQFPTIEWANLRNLIQPATTIALLAAIESLLCAVVADGMIDDRHDSNQELMAQGLAN
IAAPLFGGIAATGAIARTATNVKSGGRTPIAGIIHAITLLGIILVAAPLAKFIPLATLSA
VLVNVALNMGEWHNFARLPKWPRSDALVFLTAFGLTVIIDLTVAVEIGMVLAAVLFIKRV
SETSQITAVDEATETEGSHHSLVGKQIPERVMIYRMFGAFFFGAADKLESALRREKQEPD
VLILRMRKVMAIDATGLNALEDLYERLRRKGKSLVLSAPHTQPMFVMENAGFLERIGREN
VCPHIDAALERAREILGLPPVAMPKDPLEDERRRLQQARQELSSAIERADQALNPDGKPS
DEQAKK
Download sequence
Identical sequences B1ZSD7
WP_012375271.1.87878 gi|182414270|ref|YP_001819336.1| 452637.Oter_2454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]