SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2A5G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2A5G1
Domain Number 1 Region: 33-202
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.66e-24
Family Clp protease, ClpP subunit 0.021
Further Details:      
 
Domain Number 2 Region: 386-447
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000235
Family NfeD domain-like 0.0061
Further Details:      
 
Weak hits

Sequence:  B2A5G1
Domain Number - Region: 239-375
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00458
Family LacY-like proton/sugar symporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2A5G1
Sequence length 462
Comment (tr|B2A5G1|B2A5G1_NATTJ) Uncharacterized protein {ECO:0000313|EMBL:ACB85316.1} KW=Complete proteome; Reference proteome OX=457570 OS=JW/NM-WN-LF). GN=Nther_1742 OC=Natranaerobius.
Sequence
MDVCSKKNLRFLKVTSILVILVFLLSAIQMPVSSEENNSDPKYKLLTVEDTITAGTSQYL
EQGIENAINQGYDGVIIVLNTPGGLVDATLDIMGKIVNSPIPVITFVSPSGAIAASAGTF
ILVSGHVAAMTPGSTCGAAMPVTMQPGEEGTQEADQKTINFLAGHLKSVAREQGRPEEVV
EKFVTENLTLNASEALEKNVIEFNEPNLDALLTAIHGHEVTVAGEEITLETENARIDEAE
MTFTQQLSHFISNPQIALILFMIGIYGIIFGINMPGTIIPELGGVLSLILALFGLGMFEA
NTLGIILIVLSVILFIAEVFTPTFGILTTVGVIALVIGGFFLPVEPMLPQAWFDAFQMTV
IGMALVTAGYLALVIMKLLKIRKQSAVHKKHGMIGYRGRTTEDLNPEGYIKIRGELWRAK
SKDEEFIAKNRDVIVEQVEGIKLMVSETKRSDQEETEKEVEE
Download sequence
Identical sequences B2A5G1
gi|188586359|ref|YP_001917904.1| WP_012448183.1.10671 457570.Nther_1742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]