SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2AKE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2AKE6
Domain Number 1 Region: 95-128
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000125
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.091
Further Details:      
 
Weak hits

Sequence:  B2AKE6
Domain Number - Region: 33-70
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0373
Family Duplicated SiR/NiR-like domains 1 and 3 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2AKE6
Sequence length 442
Comment (tr|B2AKE6|B2AKE6_CUPTR) Replication protein A {ECO:0000313|EMBL:CAP63973.1} KW=Complete proteome OX=977880 OS=LMG 19424 / R1) (Ralstonia taiwanensis (strain LMG 19424)). GN=pRALTA_0311 OC=Burkholderiaceae; Cupriavidus.
Sequence
MTCSFDGLPIARRTTKCGDASHAPKPVAAEGLQPNAARLDAGRLPERILRAIALVYESDG
LRTLHITNRQVLATLVRFALNQKDPSALAFIKKATIAQHLGMSEATVYRALGALEDAGLI
KRERQRRTRAQLEVVGRIGFSSKLLRCIGITSLQVQSTIHVPTRSDESGASTCLAPVNGV
NKTMQSSTKKHPGPGSFLRIDGRAVPMDLAPLVRDQALKMSALFLLMKLARTTGHRLSDV
VSAAGNALRPLRGRELFAYLKSLLEMPVDYGHIVRTRKLREDAGRAAEARATRERQQIAE
LVARYRGKRVSAPDGSTYEVDSASIVFIDRNGRRSSVGHDQARAWLFEMDRVACGSSSGP
IQLTQPGQPSSVVARAAIETIRGLVHGRNASQELDCFGLGISKELATPRTGYGMLRKSAQ
ESKTCDSDSVDQREEIRCVMRD
Download sequence
Identical sequences B2AKE6
164546.pRALTA_0311 gi|188591571|ref|YP_001796170.1|NC_010529 gi|188591571|ref|YP_001796170.1| WP_012354636.1.21467 WP_012354636.1.63293 WP_012354636.1.84351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]