SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2ILH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2ILH1
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-52
Family Methylesterase CheB, C-terminal domain 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2ILH1
Sequence length 327
Comment (tr|B2ILH1|B2ILH1_BEII9) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=395963 OS=8712). GN=Bind_3836 OC=Beijerinckiaceae; Beijerinckia.
Sequence
MSQRDIIAIGGSLGAVEAVKNLFRDLPPGIDATILIVIHVGTVGNNYLADIFDEEASIPV
TMARDGEKLKRGHAYVAPADHHLLVMGNHIRLGRGPRENMARPAIDPLFRSIAVSHGSRT
VAVVLTGLLNDGAAGLADVKRCGGVTVVQNPREATAPQMPLEALKTGYVDYIIPLEELGN
LLKKLTKEEAGQSNEIPEGLLFEVEIALGYKTGIKKNAKIADVVPLSCPACGGVLSQLKI
GLPLRFRCQTGHAYTAETLINVKEGAVDEALRVALRMIEERVFLCEKMAEDARRSDRHAA
AKIAEERMQEYKDYADLLRRTLLGKNY
Download sequence
Identical sequences B2ILH1
gi|182676966|ref|YP_001831113.1|NC_010580 gi|182676966|ref|YP_001831113.1| 395963.Bind_3836 WP_012382982.1.21334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]