SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B2ITL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2ITL4
Domain Number 1 Region: 95-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.97e-22
Family Matrix metalloproteases, catalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2ITL4
Sequence length 271
Comment (tr|B2ITL4|B2ITL4_NOSP7) Peptidase, metallopeptidase {ECO:0000313|EMBL:ACC82722.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_R4349 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MGKKTQHQILNILINLISQRLITALALFIGTGLSIIFINLHSSYGFTIIPKYVYSGSVIS
LSTSPIPKPHPLPPTLAQWQDSTNSGDYFSQVTTTQVGYLVWSQFPIRVYVEPPKSVNEK
QAQVWVNGVLQGVKEWSNYLPLTIVEQPEIADITIARKAPPLQISPGSSKPRARSAQTTY
ELYTTNKVLSHRFTILLSPSQTGEYLIAATRHEFGHALGIWGHSPLQTDALYFSQVRNPL
PISSRDVNTLKRIYEQPTSLGWSLGDNSKIN
Download sequence
Identical sequences B2ITL4
gi|186684469|ref|YP_001867665.1| WP_012410685.1.44837 63737.Npun_R4349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]