SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2IVG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2IVG5
Domain Number 1 Region: 221-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.32e-71
Family Leukotriene A4 hydrolase catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 21-214
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.96e-49
Family Leukotriene A4 hydrolase N-terminal domain 0.0005
Further Details:      
 
Domain Number 3 Region: 568-852
Classification Level Classification E-value
Superfamily ARM repeat 3.4e-21
Family PBS lyase HEAT-like repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2IVG5
Sequence length 879
Comment (tr|B2IVG5|B2IVG5_NOSP7) Peptidase M1, membrane alanine aminopeptidase {ECO:0000313|EMBL:ACC81350.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F2817 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSKSYFDTDNNGHKPFELPGARPHYNPDRPGQVEHIFLDLSLDIPKKSYQGICSIRLLPI
RNGIDRLTLDAVNLNIESVQVDDVPQNFDYDGEQLSIKLSEVTQIGKRLLIAIAYSVAKP
QRGIYFIQPDKHYPNKPTQVWTQGEDEDSRFWFPCFDYPGQLSTSEIRVRVPNPLVAISN
GELIDTTEDGDYKIYHWLQQQVHPTYLMTLAVGDFAEIQDEWKGKPVTYYVEKGREEDAK
RSMGKTPRMIEFLSQKYGYPYPFPKYAQVCVDDFIFGGMENTSTTLLTDRCLLDERAALD
NRNTESLVVHELAHQWFGDLVVIKHWSHAWIKEGMASYSEVMWTEQEYSLEEAAYYRFLE
ARRYISEDSSRYRRPMVTHVYREAIELYDRHIYEKGSCVYHMIRAQLGDELFWQAIQTFV
QDNAHKTVETIDLLRAIEKATGHNLLFLFDQYVYRGGHPDFKVAYSWDGDAKLAKITVTQ
TQAAEDKNGSKDLFDLKIPIGFGYTQQEGKSEELGVKNNSKLTTPNSQLKTFVVRVNERE
QSFYFPLENKPQYISFDVENNYLKTVALEYPIAELKAQLESDPNPISRIYAAEALTKKGG
LEATKALSASLKNDPLWGVRVEVAKQLAKINLDQAFDGLVLGLKDKNAYVRRSVVEALAQ
IKTAESYKVVRGLLQKGDPSYYVEATASRVIGAIASANLEEKPKEDKVIKQLKGILEEKA
GWNEVVRSGAIAGLAEFKTSEAALNLLLEYTKIGVPQPLRLATIRALGKISVGQSPVNLE
RILEKLAELAKETFFLTQVAVAAALGQMETPKAVGILRSLAEQTADGRVRRNAEEEISRV
QKNIGSEKTLRQLREDFDQLKQQNQELRSRLENLEAKSK
Download sequence
Identical sequences B2IVG5
WP_012409343.1.44837 gi|186683097|ref|YP_001866293.1| 63737.Npun_F2817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]