SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2J1U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J1U2
Domain Number 1 Region: 3-187
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-60
Family Methylesterase CheB, C-terminal domain 0.0000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2J1U2
Sequence length 190
Comment (tr|B2J1U2|B2J1U2_NOSP7) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F3540 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSFKIVVIGTSLGGLSALKIILGKLPADFIVPIAIVQHRHKESNSTLQELLQESTSLPIR
EVEDKDEILPGHIYIAPADYHLLVEPGHFALSTDEPVSYARPSIDVLFESAADVYTEQVI
GVILTGANQDGMQGLKKIKARGGITIVQDPTTAESDIMPEAAISAVTVDWILTLSNIASQ
MVKLCHSSRK
Download sequence
Identical sequences B2J1U2
63737.Npun_F3540 WP_012409917.1.44837 gi|186683691|ref|YP_001866887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]