SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2J4Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J4Q8
Domain Number 1 Region: 157-339
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.15e-58
Family Methylesterase CheB, C-terminal domain 0.0000659
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 1.85e-21
Family CheY-related 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2J4Q8
Sequence length 354
Comment (sp|B2J4Q8|CHEB_NOSP7) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000255|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_R0244; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MRIAIVNDTAMAVEALKRVLLTVPGHEISWIARDGTEAVARCARDTPDLILMDLFMPVMD
GVEATRQIMKQSPCAIIIVTASVSKNAGKVFEAMGYGARDAVNVPILGTQESSDSAQLLL
TKIATIAKLIGKSSPTSTPKPQTAKLTSFSTHSTLLPPLVAIGSSTGGPKALAAILSRLP
ANFGAAIAIVQHVDMQFSAGLVDWLNQQTALTVQLATVGDRFEKGIVLVAGTNDHLSLHS
DLTLHYTKEPIDYPYRPSVDVFFKSLAQYWNAKGTAVLLTGMGQDGAQGLSLLRSRGWHT
IAQDEKSSVVYGMPKAAVQLNAAVEILPPEAIATSLIQQIMFRKSGVPKSDTRK
Download sequence
Identical sequences B2J4Q8
63737.Npun_R0244 gi|186680777|ref|YP_001863973.1| WP_012407057.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]