SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2J4S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J4S5
Domain Number 1 Region: 19-203
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.75e-63
Family Methylesterase CheB, C-terminal domain 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2J4S5
Sequence length 208
Comment (tr|B2J4S5|B2J4S5_NOSP7) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F0262 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MIQMAEDAKNNPPHFTNAGFDIVAIAASAGGLTAQIKVLSTLPAEFPAAIAIVQHISPEH
PSFMAEILSRRTDITVKQAQEGDDLSPGTAYIAPPNRHLLVNDDGTLSLSQSKLVHFLRP
SADLLFESVAATYKERAIAIVLTGTGSDGAMGVEAIKKMGGTVIVQDLKTAEFSGMPSAA
IQTGNVDFILPLDEISRVLVSLVMGKCN
Download sequence
Identical sequences B2J4S5
gi|186680794|ref|YP_001863990.1| 63737.Npun_F0262 WP_012407074.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]