SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2J7U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2J7U2
Domain Number 1 Region: 65-358
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-90
Family Thermolysin-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B2J7U2
Sequence length 359
Comment (tr|B2J7U2|B2J7U2_NOSP7) Peptidase M4, thermolysin {ECO:0000313|EMBL:ACC83907.1} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_F5602 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MARNKKKSAGFKYEHPLVSRCPICCIIPPHILEHVVVNGNPQQRNWAFRTLNVSAQFRGR
RDVIGTVSFAPSPGEKRRTIYDAKYGQQLPGTLVRGEGDPPSSDIAVNEAYDAAGATYDL
FYEIFDRNSVDDKGLRLDSTVHYGVKYDNAFWNGDQMVYGDGDGEMFQRFTTSIDVIGHE
LTHGITQYEAGLQYYGEPGALNESFSDVFGSLVKQKSKNQTAQEADWLIGEGLLVPTVKG
VALRSMKAPGTAYDDPVMGKDPQPAHVKDKYTGTDDNGGVHINSGIPNHAFYLAAVSIGG
YAWEKAGKIWYIALRDRLKAKADFKKAASVTIQIAGELYGNGSDDQKAVQDAWQKVGVI
Download sequence
Identical sequences B2J7U2
gi|186685654|ref|YP_001868850.1| WP_012411851.1.44837 63737.Npun_F5602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]