SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2JBP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2JBP3
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.98e-57
Family Methylesterase CheB, C-terminal domain 0.0000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2JBP3
Sequence length 336
Comment (tr|B2JBP3|B2JBP3_NOSP7) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=63737 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102). GN=Npun_BF231 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MLEHNIIVIGTSAGGVEALTYLVKHLPPDLKAAVIIVLHVSNHGTSVLPKILSRAGNLPA
SHAQDGEAIIHGRIYIAPPDYHLLVESVYLRLTRGPKENRHRPAIDTLFRSAARSYGQRA
IAVLLTGMLDDGTAGLVAIKMRGGVAIVQNPDDALHPDMPRNAIENVLDIDYIQPLSDIP
STLVALVNTPMKVEPENPIPDKMEFESSIVQLDLEAVKNEADRPGKPSIFGCPDCGGILW
ELEEGNLLRFRCRTGHAFSAETLLATQSDKVEDALWIAFRALEEKASLSHRMALRMEEHN
QALAAKRFKEQAESAWQHSAIIREILLKADTSTGVD
Download sequence
Identical sequences B2JBP3
gi|186687245|ref|YP_001870388.1|NC_010632 WP_012413351.1.44837 63737.Npun_BF231 gi|186687245|ref|YP_001870388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]