SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2T132 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2T132
Domain Number 1 Region: 120-287
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.03e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 409-554
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00051
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.41e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.0065
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.2e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2T132
Sequence length 559
Comment (tr|B2T132|B2T132_PARPJ) Ferredoxin--nitrite reductase {ECO:0000313|EMBL:ACD15389.1} KW=Complete proteome OX=398527 OS=(Burkholderia phytofirmans). GN=Bphyt_0970 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MYQYDQYDQTIVDERVAQYADQVRRRLSGELSEEEFRPLRLQNGLYYQRHAYMHRIAIPY
GNLRSDQMRVLAQIAREHDRGYGHFSTRSNIQYNWIKLEETPEILRKLAAVQMHGIQTSG
NCIRNITADQFAGVAPDEVVDPRPWAEILRQWSTFHPEFAWLPRKFKIAVSGSKEDRAAV
QIHDMGVYLRKNEQGELVADILAGGGMGRTPIIGAIIRKDLPWQHLLTYCEAVLRVYNRY
GRRDNMYKARIKILVKALSPEKFSAQVEEEWQHLKDGPSTLTQAEVDRVSQYFQPPVYEK
LADTDASFEKHLLENRAFARWVERNVRPHKVEGYSSVTLSLKPTTIAPGDATDAQMEAVA
DWADEYSLGEIRVSHEQNLILANVKKRDLFALWEKAKAQGFATPNIGLLTDIIACPGGDF
CSLANAKSIPIALAIQERFNDLDYVYDLGDVSLNISGCINACGHHHVGNIGILGVDKDGS
EWYQVTLGGEQGTGATGAHLGRVIGPSFSAEEMPDVMSKVIDTFVENRHEGERFIETYNR
IGITPFKERVYASRQPAHA
Download sequence
Identical sequences B2T132
gi|187922971|ref|YP_001894613.1| 398527.Bphyt_0970 WP_012432021.1.30149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]