SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2T479 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2T479
Domain Number 1 Region: 628-804
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 1-184
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.64e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.003
Further Details:      
 
Domain Number 3 Region: 146-304
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.03e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.008
Further Details:      
 
Domain Number 4 Region: 498-636
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.29e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2T479
Sequence length 846
Comment (tr|B2T479|B2T479_PARPJ) Nitrite reductase (NAD(P)H), large subunit {ECO:0000313|EMBL:ACD16390.1} KW=Complete proteome OX=398527 OS=(Burkholderia phytofirmans). GN=Bphyt_1983 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MKIIVIGHGMVGHKLVECLAQDAAHGLDITVLCEESRPAYDRVHLSEFFAGKTADDLSLV
EPGFFERQNVLLKLNAKAVAIDRDARTVTVSTGETLPYDKLVFATGSYPFVPPVQGRERA
DCFVYRTIDDLEAMRECGARSKTGTVVGGGLLGLECAKALRDMGLQTHVVEFAPRLMAVQ
VDDGGGRVLRGKIEELGVTVHMQKNTTAIVDGEAGTHRMQFADGSHLDTDMIVFSAGIRP
RDDLARASGLTLGPRGGIVIDNACRTSDPHIYAIGECALWNGQLFGLVAPGYDMARAVAK
QLLGDTAEFAGADMSTKLKLMGVDVASIGDAHGNTPGSRAYQFSDERKQVYKKLVVSECG
KYLLGGVMVGDAAEYGTLLQMMLNRIELPASPEFLILPAADGNAKPALGVDSLPASAQIC
SCNNVSKGELCAAVCAGATDIGALKCATTAGTSCGGCVPLVTQVMKAEMKKQGLAVNNHV
CEHFAYSRQELYHIVRVEGVRSFGELLAKHGHGLGCDICKPVVASVLASCWNEFVLKKEH
ASLQDTNDYYLANIQRDGTYSVVPRMAGGEVTPDGLIAVGQVAKKYGLYTKITGGQRVDL
FGARVEQLPLIWEELIAAGFESGHAYGKSLRTVKSCVGSTWCRYGVGDSVGLAVEIENRY
KGLRTPHKIKFGVSGCTRECAEAQGKDVGIIATEKGWNLYVCGNGGMKPRHAELLASDLD
KETLVRYIDRFLMFYVRTADRLQRTSVWRENLEGGLDYLIDVVVNDHLGVADELESEMQH
VVDTYECEWKKAVTDPETRKRFRHFVNSGESDSNVAFVEERGQIRPATPAERRSKLAAIP
VVVETV
Download sequence
Identical sequences B2T479
WP_012432989.1.30149 398527.Bphyt_1983 gi|187923972|ref|YP_001895614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]