SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2T8V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2T8V3
Domain Number 1 Region: 116-369
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.72e-66
Family D-glucarate dehydratase-like 0.00036
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.84e-30
Family Enolase N-terminal domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B2T8V3
Sequence length 377
Comment (tr|B2T8V3|B2T8V3_PARPJ) Mandelate racemase/muconate lactonizing protein {ECO:0000313|EMBL:ACD20766.1} KW=Complete proteome OX=398527 OS=(Burkholderia phytofirmans). GN=Bphyt_6459 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MKIADIVAYPVTVPVPPQYQVSLGIGRMVKRDTVIVKVTTDEGIVGWGESHHGRAHLAIA
MLVNTTLKQLVADLEATDVNGVWSQIYRYQLASHGMGAACAAAMSGIDMALWDIRGKATG
WPLYRLLGGTSRSVPAYAGGICLGFQTPSALLEEVETMVRRGYKAIKLRLGDSPANDIAR
VAAVREAYPELDILTDANTAYSLRDFRMVAPHLDAAHVGWLEEPFPAHDYRSYREAKKMC
RFALAGGENHFTRFEFAQLIDAESITILQPDLSKVGGISEAMKVATMASVQKLPVHCHSS
MGINMAATLHVLSAIDNAGYFEADCSLYNPLRDDLIDFSFAINADGTLRPSEKPGIGIEI
NEDFIKHHAGSSGPGFV
Download sequence
Identical sequences B2T8V3
398527.Bphyt_6459 WP_012428274.1.30149 gi|187921105|ref|YP_001890137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]