SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B2TB95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B2TB95
Domain Number 1 Region: 15-94
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000182
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B2TB95
Sequence length 130
Comment (tr|B2TB95|B2TB95_PARPJ) Uncharacterized protein {ECO:0000313|EMBL:ACD20837.1} KW=Complete proteome OX=398527 OS=(Burkholderia phytofirmans). GN=Bphyt_6534 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MFRKLQDPSLADTLQITVDGEAVGAMEGETVAGVLMRRAVLLTRQTPVSGMLRAPYCMMG
VCFECLAVVDGIASVQTCLTTVRDGMCVERQRGRRTVELEVCSGRDFTEDGEREAAPPRE
DEAVRDEKKI
Download sequence
Identical sequences B2TB95
gi|187921176|ref|YP_001890208.1| 398527.Bphyt_6534 WP_012428341.1.30149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]