SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3CMS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3CMS6
Domain Number 1 Region: 537-1032
Classification Level Classification E-value
Superfamily ALDH-like 4.84e-130
Family ALDH-like 0.000000278
Further Details:      
 
Domain Number 2 Region: 178-523
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.92e-107
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000177
Further Details:      
 
Domain Number 3 Region: 8-177
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.96e-58
Family N-terminal domain of bifunctional PutA protein 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3CMS6
Sequence length 1046
Comment (tr|B3CMS6|B3CMS6_WOLPP) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome OX=570417 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip). GN=WP1090 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
MISSIQEPNELRKRLQGFYRTDEKSCVRYLVEKVELSVDSKNRIYNIAKQIVEKIRGSKL
GIIDSFIQQYSLSNDEGVALMCLAESLLRIPDDYTIDELIKDKIANQEWNKHLGRSSSLF
VNASTWSLIIGSSILRNNEEDSKFYNIISRLLKNLGEPIIRKAVKQAISILGKHFIVGET
IEKALESVKSDDYSKYLCSFDMLGESACTVEDAEEYFNLYMHAIKAIGESADINDCFKSQ
GVSIKLSSLHSRYEFSQFDNMAEELRTKVLELCHEAKKYNISLCIDAEESERLEMSLVLF
EQLRLDESLSEWEGLGLAVQAYQKRALSVLDFVEDVAIRSKHKVMVRLVKGAYWDSEIKR
TQELGLIGYPVFTRKSHTDVCYLACAQKLLSKENHFYPCFGTHNAYTFATIIELADKNHP
GFEFQRLHGMGKSLYDYAISELATSINCRIYAPVGKHSDLLPYLIRRLLENGANSSFVNQ
VNDSDVKIEELVSDPLEKVKSLEYEPHPSIPLPRDIFGEERKNSLGMDISDSIAVSQFAN
DVREFSEKKWQVGPIIDGESFLDSAEFTEVVNPAHLENVIGEVSSATSAHALNALEIAHS
AFTKWQNVSAEERAKCLEKAADLLEERMKELIYILIVEAGKILSDAIAEVREAIDFLRYY
AMIAKNELNDWKKLPGPTGEDNFIFFEGRGVFLCISPWNFPLAIFIGQVSAALAAGNAVL
AKPAEQTPIIAYEAVKILHEAGIPKNVLHLIPGDGWYLGKTLVPDNRISGVAFTGSTQTA
QIINRMLASRDGPIVPLIAETGGLNAMIVDSSALLEQVTKDVLISAFRSGGQRCSALRVL
FIQEDIAEKQVKMICNAAQELKIGDPIQLSTDIGPIIDKASIDMLTKHTEKISRDEDSNL
LFKVPMDTNSYNGYFFPPYIYEIQKISQLKQEVFGPILHIIRFNKSQLNEVISDINNTGY
GLTFSLQSRVQSQIALISKKISVGNVYINRNQIGAAVGTQPFGGRGLSGTGPKAGGPNYL
QRFSIEKVVSVNTTACGGNIKLACLD
Download sequence
Identical sequences A0A0U1D0C1 B3CMS6 B6Y731
gi|190571475|ref|YP_001975833.1| WP_007302469.1.17329 WP_007302469.1.26101 WP_007302469.1.2611 WP_007302469.1.9798 570417.WPa_1090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]