SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3H5D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3H5D4
Domain Number 1 Region: 181-371
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-32
Family BCR-homology GTPase activation domain (BH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 16-130
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-17
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3H5D4
Sequence length 772
Comment (tr|B3H5D4|B3H5D4_ARATH) Rho GTPase activation protein (RhoGAP) with PH domain-containing protein {ECO:0000313|EMBL:AED91769.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At5g12150 OC=Arabidopsis.
Sequence
MEASLAVIQRPQAGASNTVYKSGPLFISSKGLGWTSWKKRWFILTRTSLVFFKNDPSALP
QKGGEVNLTLGGIDLNSSGSVVVREDKKLLTVLFPDGRDGRAFTLKAETLDDLYEWKAAL
EQALAQAPNAALVIGQNGIFRTEANNTIEASFNSWRDQRPLKSSVVGRPILLALEEIDGS
PSFLEKALQFLETYGTKVEGILRQSADVEEVERRVQEYEQGKTEFSPEEDPHVVGDCVKH
VLRQLPSSPVPASCCTALLEAYKIDQNEARVNSLRSAIIETFPEPNRRLLLRMLKMMHTI
TSHSSENRMTSSAVAACMSPLLLRPLLAGECDLEGFDTLGDNSAQLLAAANAANNAQAIV
TALLEDYGNMINDEGLGRCSTSTDSHIGDSGPENSSDEEEIVVKHPDLHTLDIEEGETDD
DNDVLLSRKPSESSDYAGSDLYDYKGFGVEDSDAESPRDIHCSVESTDFSARVKKHIEEP
IKDIEVSSVSPTENCYQSGREAIPSVTPSTPLTALRYTTSAEKPASKTTGSSTVNSKRSS
SWGRGNGKKTPAKGSFDSSGNDELLIQRLEHMKDELRQRIAKEAKGNAALQASLERRKQA
LHERRLALEQDVGRLQEQLQAERDLRSALEVGLSISCGQFSSQAADSKTRAELEEIALAE
ADVARLKQKVAELHHQLSQQRQHHLSSLPDAQSHHQFLHNHNTQLKSFQQDFDSILAFVN
HERNQRTDETSLRADWRNGRGNNRQVPGSPSLNAASLGIPMEEYSPVSDSLV
Download sequence
Identical sequences B3H5D4
AT5G12150.2 NP_001119213.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]