SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3N7W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3N7W4
Domain Number 1 Region: 341-419
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.01e-16
Family PCI domain (PINT motif) 0.047
Further Details:      
 
Weak hits

Sequence:  B3N7W4
Domain Number - Region: 98-187,234-343
Classification Level Classification E-value
Superfamily TPR-like 0.000531
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3N7W4
Sequence length 444
Comment (tr|B3N7W4|B3N7W4_DROER) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KQS70362.1} KW=Complete proteome OX=7220 OS=Drosophila erecta (Fruit fly). GN=Dere_GG24040 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSDNDDDFMCDDDEDYGLEYSEDSNSEPDVDLENQYYNSKALKEEEPKAALASFQKVLDL
ENGEKGEWGFKALKQMIKINFRLCNYDEMMVRYKQLLTYIKSAVTRNHSEKSINSILDYI
STSKNMALLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYFDRSDFTKLQKILKQLHQSC
QTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE
CGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEA
KPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVL
IKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQLDKINSSAS
RYNALEKWSNQIQSLQFAVVQKMA
Download sequence
Identical sequences A0A1W4WDJ4 B3N7W4 B4HYU0 B4NXL4 B4Q7C6 M9PFB5 Q94899
FBpp0220770 FBpp0142586 FBpp0194060 FBpp0079381 FBpp0089195 7227.FBpp0079381 7245.FBpp0255653 FBpp0255653 NP_001260276.1.81976 NP_001285771.1.81976 NP_523517.1.81976 NP_723438.1.81976 XP_001969266.1.56816 XP_002036297.1.34323 XP_002078735.1.80810 XP_002088893.1.41174 XP_015015016.1.56816 XP_016973864.1.97277 XP_017006324.1.47939 XP_017033957.1.37106 XP_017062342.1.74164 XP_017076108.1.81094 FBpp0079381 FBpp0089195 FBpp0303869 IGBMC-0066-000 FBpp0079381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]