SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3P6T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3P6T1
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-29
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 3e-21
Family L27 domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3P6T1
Sequence length 195
Comment (tr|B3P6T1|B3P6T1_DROER) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} KW=Complete proteome OX=7220 OS=Drosophila erecta (Fruit fly). GN=Dere_GG12292 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MADNAEPLTLSKDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ
Download sequence
Identical sequences B3P6T1
FBpp0130838 XP_001981881.1.56816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]