SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3QJ79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3QJ79
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.09e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3QJ79
Sequence length 186
Comment (tr|B3QJ79|B3QJ79_RHOPT) Pyruvate ferredoxin/flavodoxin oxidoreductase {ECO:0000313|EMBL:ACE99960.1} KW=Complete proteome OX=395960 OS=Rhodopseudomonas palustris (strain TIE-1). GN=Rpal_1421 OC=Bradyrhizobiaceae; Rhodopseudomonas.
Sequence
MSTSRIELRFGGTGGQGLLLSAKLLADALALEGRHVAQSQTYEPTSRGGFCNADLVVAHG
EVDYPLPIEFDHLVLLDKIAIKPSWPKLKAGALVISDVRLCPELPEGGRFKRYPLPLSRT
AIELGSERVTNIVALGVLIELSGICKHKSVEQVVRASSPRGFLDLNMDALAAGYALAKTP
AVAAAS
Download sequence
Identical sequences B3QJ79
395960.Rpal_1421 WP_012494910.1.13849 gi|192289831|ref|YP_001990436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]