SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3R009 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3R009
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 2.22e-16
Family Ribosomal protein L30p/L7e 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B3R009
Sequence length 61
Comment (tr|B3R009|B3R009_PHYMT) 50S ribosomal protein L30 {ECO:0000256|SAAS:SAAS00380738} KW=Complete proteome; Reference proteome OX=482235 OS=Phytoplasma mali (strain AT). GN=ATP_00359 OC=16SrX (Apple proliferation group).
Sequence
MKKPQFIIILNKSLIARTKSQIQTAHILGLRKINQKVIKDDNPVNRGMIRKIYHLVTIEK
L
Download sequence
Identical sequences B3R009
WP_012504505.1.43358 gi|194246751|ref|YP_002004390.1| 37692.ATP_00359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]