SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3TN71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3TN71
Domain Number 1 Region: 49-106
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.29e-19
Family Ribosomal protein S18 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3TN71
Sequence length 163
Comment (tr|B3TN71|B3TN71_BRADI) 30S ribosomal protein S18, chloroplastic {ECO:0000256|HAMAP-Rule:MF_00270} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BN3904_03068 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MYTSKQPFLKSKQPFRKSKQTFNKSKQPFRKSKQTFRKSKQPFRRRPRIGPGDRIDYRNM
SLINRFISEQGKILSRRINRLTLKQQRLITLAIKQARILSFLPFRNYENEKQFQAQSISI
ITGSRPRKNRHIPQLTQKYSSNRNVRNYNQNLRNNNRNLSSDC
Download sequence
Identical sequences B3TN71
EG:BRADI1G05752.1 YP_002000507.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]