SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B3U4H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3U4H6
Domain Number 1 Region: 3-429
Classification Level Classification E-value
Superfamily L-aspartase-like 7.54e-131
Family L-aspartase/fumarase 0.000000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B3U4H6
Sequence length 444
Comment (tr|B3U4H6|B3U4H6_9BACT) Adenylosuccinase {ECO:0000256|RuleBase:RU361172} KW=Complete proteome; Reference proteome OX=330214 OS=Nitrospira defluvii. GN=NIDE1386 OC=Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
Sequence
MIDRYTRPQMSAIWDLQHKYEIWLEVELQACAAFERGGQIPRGTSARIRKKAKIDVARIA
DIEKVTKHDVIAFLESLMDSVGPEHRFLHMGLTSSDIVDTSLAVQMTEALDLILEDLDEL
IAVLKKRAIEHRHTVMVGRSHGIHGEPVSFGFKLAIWYEEACRHRTRLEAARKDIAVGKL
SGAMGTFAHQGPEIEEYVCAKMGLASDPVSNQIVQRDRHAAYASALALLAATIEKIATEI
RHLQRTEVLEAEEYFSVGQKGSSAMPHKRNPIASENLCGLARLVRGNSLAALENVALWHE
RDISHSSVERVIMPDSTILVDYMLARVTDLVKNLIVYPERMQRNLDLTGGLVYSQRLLLA
LIDKGAQRKESYEAVQRNAMTAWKGGVGFQELVGRDPFITTHLKPHEITACFDPAYYLRH
LDQVFRRVFGSSGASSAKRRRSRA
Download sequence
Identical sequences B3U4H6
gi|302036740|ref|YP_003797062.1| WP_013247961.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]