SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B4DPW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4DPW9
Domain Number 1 Region: 94-596
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.27e-162
Family Calponin-homology domain, CH-domain 0.00000000218
Further Details:      
 
Domain Number 2 Region: 5-115
Classification Level Classification E-value
Superfamily EF-hand 0.000000946
Family Eps15 homology domain (EH domain) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4DPW9
Sequence length 603
Comment (tr|B4DPW9|B4DPW9_HUMAN) cDNA FLJ51929, highly similar to Plastin-3 {ECO:0000313|EMBL:BAG60731.1} OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKIFQEVKSS
DIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVI
PMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAI
GCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKL
SPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSG
FNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQD
IDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNK
PPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTL
NVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCI
NYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGM
KRV
Download sequence
Identical sequences A0A2K5IEX9 A0A2K5XXA2 B4DPW9 F6WTT7
gi|288915539|ref|NP_001165806.1| NP_001165806.1.87134 NP_001165806.1.92137 XP_003262276.1.23891 XP_011812923.1.43180 XP_011839871.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]